| Protein or peptide name: | MgrB |
| Chromosome: | str. K-12 substr. MG1655, complete genome |
| Protein or peptide start site: | 1908623 |
| Protein or peptide end site: | 1908766 |
| ncRNA start site: | 1908623 |
| ncRNA end site: | 1908766 |
| Genome Browser: | NA |
| Protein or peptide sequence: | MKKFRWVVLVVVVLACLLLWAQVFNMMCDQDVQFFSGICAINQFIPW |
| Protein or peptide length: | 47aa |
| ncRNA type: | ncRNA |
| ncRNA name: | mgrB |
| Entrez ID: | 946351 |
| Experimental species: | Escherichia coli |
| Experimental techniques: | Fluorescence microscopy/Western blotting |
| Experimental sample (cell line and/or tissue): | E. coli |
| Description: | We found that deletion of mgrB (yobG), which encodes a 47 amino acid peptide, results in a potent increase in PhoP-regulated transcription. |
| Subcellular location: | inner membrane |
| Function: | MgrB is a broadly conserved membrane peptide that is a critical mediator of negative feedback in the PhoQ/PhoP circuit. |
| Title of paper: | Feedback inhibition in the PhoQ/PhoP signaling system by a membrane peptide |
| PMID: | 20041203 |
| Year of publication: | 2009 |
